PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do024245.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family TALE
Protein Properties Length: 277aa    MW: 30517.2 Da    PI: 7.2343
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do024245.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.65e-091932262255
                 SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                  +yps+ e++ LA+++gL+ +q+ +WF N+R ++
  Do024245.1 193 WPYPSELEKAALAESTGLDAKQINNWFINQRKRH 226
                 69*****************************885 PP

2ELK35.52.1e-12146167122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELK++Ll+KYsgyL+sL+ E+s
  Do024245.1 146 ELKNRLLNKYSGYLSSLWRELS 167
                 9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012556.9E-859101IPR005540KNOX1
PfamPF037902.0E-116183IPR005540KNOX1
PfamPF037918.4E-682106IPR005541KNOX2
PfamPF037891.2E-9146167IPR005539ELK domain
SMARTSM011889.5E-7146167IPR005539ELK domain
PROSITE profilePS5121310.51146166IPR005539ELK domain
PROSITE profilePS5007112.471166229IPR001356Homeobox domain
SuperFamilySSF466896.42E-18168233IPR009057Homeodomain-like
SMARTSM003891.5E-11168233IPR001356Homeobox domain
CDDcd000869.64E-13169229No hitNo description
Gene3DG3DSA:1.10.10.601.9E-25171230IPR009057Homeodomain-like
PfamPF059205.6E-16186225IPR008422Homeobox KN domain
PROSITE patternPS000270204227IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MEQLPVLASG SKATTTTPFY LALDHGASTS SLPPAEAPTP PPSAVSDPSR QSSSERGPEI  60
IKAKIMSHPL YPALLRAFID CQKELTRPIQ EADEFFRSME AQIDSFSLDD NGYEGGGSSD  120
EDEQETVDLA GLPVPETGSP SGEDKELKNR LLNKYSGYLS SLWRELSRKK KKGKLPRDAR  180
QKLLHWWQLH YRWPYPSELE KAALAESTGL DAKQINNWFI NQRKRHWKPA PPALALATDY  240
RLRPHIGGGA SSSSSASAAL HVEGQYFVGG SSYPRGP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0352050.0BT035205.1 Zea mays full-length cDNA clone ZM_BFb0044N12 mRNA, complete cds.
GenBankBT0406220.0BT040622.1 Zea mays full-length cDNA clone ZM_BFc0104L02 mRNA, complete cds.
GenBankKJ7275710.0KJ727571.1 Zea mays clone pUT5431 HB transcription factor (HB110) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982196.11e-160PREDICTED: homeobox protein knotted-1-like 4
SwissprotQ75LX71e-113KNOS4_ORYSJ; Homeobox protein knotted-1-like 4
TrEMBLK4ACH31e-160K4ACH3_SETIT; Uncharacterized protein
STRINGSi036580m1e-159(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47462950
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.14e-48KNOTTED-like from Arabidopsis thaliana